PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.K02085.1.p
Common NameEUGRSUZ_K02085, LOC104425677
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family FAR1
Protein Properties Length: 218aa    MW: 24923.4 Da    PI: 9.6928
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.K02085.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR196.82.4e-3047134290
              FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                       fY++YA+++GF +r+++ ++s r+g++++r++vC+keg+r+++ ++ +++r++ra tr gCka+++vkk+k+gkw+vtk+ +eHnH+l 
  Eucgr.K02085.1.p  47 FYDTYATHMGFIMRVDAFRRSMRDGKVVWRRLVCNKEGFRKSRPRR-SENRKPRAITREGCKAMIVVKKDKTGKWVVTKFIKEHNHPLI 134
                       9*******************************************99.9***************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.2E-2847134IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MDERPSVVED GDAIECSSGK DAPNEESSDM EPSVGMEFES EEAAKVFYDT YATHMGFIMR  60
VDAFRRSMRD GKVVWRRLVC NKEGFRKSRP RRSENRKPRA ITREGCKAMI VVKKDKTGKW  120
VVTKFIKEHN HPLIAAPANS HRSVLLSQKP DEKDVKIREL TAELQRERKR SAAYLEQLEM  180
VLRDMEEHSG RLSKSIEVIV KSVREIDSRR APVSSSQ*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.K02085.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010036738.11e-159PREDICTED: protein FAR1-RELATED SEQUENCE 5 isoform X1
SwissprotQ9SZL82e-31FRS5_ARATH; Protein FAR1-RELATED SEQUENCE 5
TrEMBLA0A059A3W61e-159A0A059A3W6_EUCGR; Uncharacterized protein
STRINGVIT_00s0174g00120.t011e-120(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM135242227
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07500.15e-87FAR1 family protein